Description

  • Product name

    Recombinant Human GLP1R protein (His tag)
    See all GLP1R proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWP DGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDL SECEESKRGERSSPEEQLLFLY
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      24 to 145
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl, 2.9% Sodium chloride

General Info

  • Alternative names

    • GLP
    • GLP 1 R
    • GLP 1 receptor
    • GLP 1R
    • GLP-1 receptor
    • GLP-1-R
    • GLP-1R
    • GLP1R
    • GLP1R_HUMAN
    • Glucagon like peptide 1 receptor
    • Glucagon-like peptide 1 receptor
    • MGC138331
    • OTTHUMP00000016340
    see all
  • Function

    This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab239555.

References

ab239555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up