Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPC PSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQN VDRYALLSTL
    • Amino acids

      69 to 178
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GLP 2 R
    • GLP 2 receptor
    • GLP 2R
    • GLP-2 receptor
    • GLP-2-R
    • GLP-2R
    • GLP2 R
    • GLP2 Receptor
    • GLP2R
    • GLP2R_HUMAN
    • Glucagon Like Peptide 2 Receptor
    • Glucagon-like peptide 2 receptor
    see all
  • Function

    This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab160440 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up