Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMALLAEHLLKPLPADKQIETGPFLEAV SHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTLQNILEVE KEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVN ATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECL EKIRLFLVNYTATIDVIYEMYTQMNAELNYKV
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 209
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab139249 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • GLTP
    • GLTP_HUMAN
    • Glycolipid transfer protein
  • Function

    Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides.
  • Tissue specificity

    Detected in fibroblasts (at protein level). Detected in fibroblasts and in various cancer cell lines.
  • Sequence similarities

    Belongs to the GLTP family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139249.

References

ab139249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up