Overview

  • Product name

    Recombinant Human GluA4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFL HNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDK RSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYE WNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEE LDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLE RFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLK QVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQ DVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN
    • Molecular weight

      76 kDa including tags
    • Amino acids

      1 to 433
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This is Isoform 2 of Glutamte Receptor 4

Specifications

Our Abpromise guarantee covers the use of ab152441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as Ionotropic Glutamate receptor 4.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AMPA 4
    • AMPA selective glutamate receptor 4
    • AMPA-selective glutamate receptor 4
    • AMPA4
    • GluA 4
    • GluA4
    • GluR 4
    • GluR D
    • GluR-4
    • GluR-D
    • GluR4
    • GLUR4C
    • GLURD
    • Glutamate receptor 4
    • Glutamate receptor ionotrophic AMPA 4
    • Glutamate receptor ionotropic
    • GRIA 4
    • Gria4
    • GRIA4_HUMAN
    • Ionotropic Glutamate receptor 4
    see all
  • Function

    Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIA4 subfamily.
  • Post-translational
    modifications

    Palmitoylated. Depalmitoylated upon glutamate stimulation. Cys-611 palmitoylation leads to Golgi retention and decreased cell surface expression. In contrast, Cys-837 palmitoylation does not affect cell surface expression but regulates stimulation-dependent endocytosis.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152441 stained with Coomassie Blue.

References

ab152441 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up