Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNED KRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE GTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGS FSDEMNTILDNLAARDFINWLIQTKITDRK
    • Molecular weight

      46 kDa including tags
    • Amino acids

      1 to 180

Specifications

Our Abpromise guarantee covers the use of ab132833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GCG
  • Relevance

    Glucagon is a hormone that is secreted by alpha cells in the pancreas. Glucagon antagonizes insulin by converting glycogen to glucose in the liver and increasing blood sugar levels. Glucagon-like peptide 1 (GLP1), Glucagon-like peptide 2 (GLP2), VIP (vasoactive intestinal peptide) and PACAP (pituitary adenylate cyclase activating polypeptide) are in the glucagons hormone family. GLP1 is a transmitter in the central nervous system that regulates feeding and drinking behavior. GLP2 stimulates intestinal epithelial growth.
  • Cellular localization

    Secreted

Images

  • 12.5% SDS-PAGE analysis of ab132833 stained with Coomassie Blue.

References

ab132833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up