For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-glucokinase-protein-ab123840.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

Recombinant human Glucokinase protein (ab123840)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human Glucokinase protein (ab123840)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 80% SDS-PAGE
    • Active: Yes
    • Tags: DDDDK tag C-Terminus
    • Suitable for: Functional Studies, SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human Glucokinase ELISA Kit (GCK) (ab125967)

    View more associated products

    Description

    • Product name

      Recombinant human Glucokinase protein
      See all Glucokinase proteins and peptides
    • Biological activity

      Biological Activity: 303 pmol/min/µg. One unit is defined as the amount of enzyme that will convert 1 pmol of NADP to NADPH at 30oC. Assay conditions: 25 mM HEPES, pH 7.5, 2 mM MgCl2, 1.0 mM DTT, 0.5 mM NADP, 2.0 mM ATP, 25 mM glucose, 100 µg/ml BSA, 20 units/ml glucose 6-phosphate dehydrogenase, and 10 nM human pancreatic glucokinase at 30°C for 30 min.

    • Purity

      > 80 % SDS-PAGE.

    • Expression system

      Escherichia coli
    • Accession

      P35557
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MLDDRARMEAAKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETH EEASVKMLPT YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQ WSVKTKHQMYSIPEDAMTGTAE MLFDYISECISDFLDKHQMKHKKLPL GFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN VVGLLRDAIKRRGD FEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQN VE LVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKL IGGKYMGE LVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVES DTGDRKQIYNILSTLGLRPS TTDCDIVRRACESVSTRAAHMCSAGLAG VINRMRESRSEDVMRITVGVDGSVYKLHPSFK ERFHASVRRLTPSCEI TFIESEEGSGRGAALVSAVACKKACMLGQ
      • Predicted molecular weight

        53 kDa including tags
      • Amino acids

        1 to 465
      • Tags

        DDDDK tag C-Terminus

    Associated products

    • Related Products

      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab1162)
      • Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody (ab21536)

    Specifications

    Our Abpromise guarantee covers the use of ab123840 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      SDS-PAGE

    • Form

      Liquid
    • Additional notes

      303 pmol/min/µg. One unit is defined as the amount of enzyme that will convert 1 pmol of NADP to NADPH at 30°C. Assay conditions: 25 mM HEPES, pH 7.5, 2 mM MgCl2, 1.0 mM DTT, 0.5 mM NADP, 2.0 mM ATP, 25 mM glucose, 100 µg/ml BSA, 20 units/ml glucose 6-phosphate dehydrogenase, and 10 nM human pancreatic glucokinase at 30°C for 30 min.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      Constituents: 1.06% Potassium phosphate, 0.008% DTT, 0.015% EDTA, 2.5% Glycerol (glycerin, glycerine), 0.29% Sodium chloride

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    General Info

    • Alternative names

      • ATP:D-hexose 6-phosphotransferase
      • FGQTL3
      • GCK
      • GK
      • GLK
      • Glucokinase
      • Hexokinase D pancreatic isozyme
      • Hexokinase type IV
      • Hexokinase-4
      • Hexokinase-D
      • HHF3
      • HK IV
      • HK4
      • HKIV
      • HXK4_HUMAN
      • HXKP
      • LGLK
      • MODY2
      see all
    • Function

      Catalyzes the initial step in utilization of glucose by the beta-cell and liver at physiological glucose concentration. Glucokinase has a high Km for glucose, and so it is effective only when glucose is abundant. The role of GCK is to provide G6P for the synthesis of glycogen. Pancreatic glucokinase plays an important role in modulating insulin secretion. Hepatic glucokinase helps to facilitate the uptake and conversion of glucose by acting as an insulin-sensitive determinant of hepatic glucose usage.
    • Tissue specificity

      Isoform 1 is expressed in pancreas. Isoform 2 and isoform 3 is expressed in liver.
    • Involvement in disease

      Defects in GCK are the cause of maturity-onset diabetes of the young type 2 (MODY2) [MIM:125851]; also shortened MODY-2. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
      Defects in GCK are the cause of familial hyperinsulinemic hypoglycemia type 3 (HHF3) [MIM:602485]; also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur.
    • Sequence similarities

      Belongs to the hexokinase family.
    • Target information above from: UniProt accession P35557 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant human Glucokinase protein (ab123840)
      SDS-PAGE - Recombinant human Glucokinase protein (ab123840)
      SDS-PAGE showing ab123840 (10µg).

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (1)

    Publishing research using ab123840? Please let us know so that we can cite the reference in this datasheet.

    ab123840 has been referenced in 1 publication.

    • Cho J  et al. L-Arginine prevents cereblon-mediated ubiquitination of glucokinase and stimulates glucose-6-phosphate production in pancreatic ß-cells. Commun Biol 3:497 (2020). PubMed: 32901087

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab123840.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.