Overview

  • Product name
    Recombinant Human Glucose Transporter 8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPA IPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSL LLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAY PAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMC FMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQ PGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGV IQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNS SHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEI FPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIF SVLFTLFCVPETKGKTLEQITAHFEGR
    • Amino acids
      1 to 477
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glucose transporter type 8
    • Glucose transporter type X1
    • GLUT8
    • GLUTX1
    • solute carrier family 2 (facilitated glucose transporter) member 8
    see all
  • Relevance
    Glucose transporter 8 is an insulin-regulated facilitative glucose transporter. It binds cytochalasin B in a glucose-inhibitable manner. It appears to be a dual-specific sugar transporter as it can be inhibited by fructose. It is highly expressed in testis, where it is down-regulated by estrogen, but not in testicular carcinoma. Lower amounts are present in most other tissues.
  • Cellular localization
    Cell Membrane; multi-pass membrane protein. Principally intracellular. May move between intracellular vesicles and the plasma membrane

Images

  • ab162301 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up