Description

  • Product name

    Recombinant Human Glucose Transporter GLUT4 protein
    See all Glucose Transporter GLUT4 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQK VIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIG IISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAYSG LTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTAS LWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGW ADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRR TLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPG PIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVF LLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTEL EYLGPDEND
    • Amino acids

      1 to 509
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Glucose transporter GLUT 4
    • Glucose transporter type 4
    • Glucose transporter type 4 insulin responsive
    • GLUT 4
    • GLUT-4
    • GLUT4
    • GTR4_HUMAN
    • Insulin responsive glucose transporter type 4
    • insulin-responsive
    • kug
    • SLC 2A4
    • SLC2A4
    • solute carrier family 2 (facilitated glucose transporter) member 4
    • Solute carrier family 2 member 4
    • Solute carrier family 2, facilitated glucose transporter member 4
    see all
  • Function

    Insulin-regulated facilitative glucose transporter.
  • Tissue specificity

    Skeletal and cardiac muscles; brown and white fat.
  • Involvement in disease

    Diabetes mellitus, non-insulin-dependent
  • Sequence similarities

    Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Cell membrane. Endomembrane system. Cytoplasm, perinuclear region. Localizes primarily to the perinuclear region, undergoing continued recycling to the plasma membrane where it is rapidly reinternalized. The dileucine internalization motif is critical for intracellular sequestration.
  • Information by UniProt

Images

  • ab159519 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up