Overview

  • Product name

    Recombinant Human GLUD2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGID PKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAP RVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLK NLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQ DSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIE KVFKVYSEAGVTFT
    • Molecular weight

      55 kDa including tags
    • Amino acids

      295 to 558
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DHE4_HUMAN
    • GDH
    • GDH 2
    • GDH2
    • GLUD2
    • GLUDP1
    • Glutamate dehydrogenase 2
    • Glutamate dehydrogenase 2 mitochondrial
    • Glutamate dehydrogenase pseudogene 1
    • mitochondrial
    see all
  • Function

    Important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission.
  • Tissue specificity

    Expressed in retina, testis and, at a lower level, brain.
  • Sequence similarities

    Belongs to the Glu/Leu/Phe/Val dehydrogenases family.
  • Post-translational
    modifications

    Stoichiometry shows that ADP-ribosylation occurs in one subunit per catalytically active homohexamer.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132807 stained with Coomassie Blue.

References

ab132807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up