Overview

  • Product name

    Recombinant human Glutaminase protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      M HHHHHH SPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLH PWWGGGGWP AEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAP GPKDGPGETDAF GNSEGKE LVASGENKIKQGLLPSLEDLLFYTIAE GQEKIPVHKFITALKSTGLRTSDP RLKECMDML RLTLQTTSDGVML DKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDE LYESAKKQS GGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPL KY AIAVNDL GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAG AIVVTSLIKQGVNN AEKFDYV MQFLNKMAGNEYVGFSNATFQSERE SGDRNFAIGYYLKEKKCFPEGTDMVG ILDFYFQ LCSIEVTCESASV MAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYD FSGQFAFH VGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLC N FHNYDN LRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRR FALSAMDMEQRD YDSRTAL HVAAAEGHVEVVKFLLEACKVNPFPKD RWNNTPMDEALHFGHHDVFKILQE YQVQYTP QGDSDNGKENQTVHK NLDGLL
    • Molecular weight

      73 kDa including tags
    • Amino acids

      17 to 669
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 17 to 669. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab198065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity


    Specific Activity: ≥ 25 nmol/min/µg


    Assay Conditions:
    The reaction mixture contained 100 mM Tris, pH 8.6, 150 mM K2HPO4, 25 mM L-glutamine, 2 mM NAD+, 4 units of GDH, and various amounts of ab198065 in a volume of 200 μl. Reactions were initiated with the addition of ab198065, and the increase in NADH absorbance at 340 nm was continuously monitored for 7 minutes at 37°C. Molar extinction coefficient of NADH is 6,220 M-1cm-1.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 74 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.77% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AAD20
    • DKFZp686O15119
    • FLJ10358
    • GAC
    • GAM
    • GLS
    • GLS1
    • GLSK_HUMAN
    • Glutaminase C
    • Glutaminase kidney isoform
    • Glutaminase phosphate activated
    • K-glutaminase
    • KGA
    • KIAA0838
    • L glutamine amidohydrolase
    • L-glutamine amidohydrolase
    • mitochondrial
    see all
  • Function

    Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine.
  • Tissue specificity

    KGA is expressed predominantly in brain and kidney but not in liver, isoform 3 is expressed principally in cardiac muscle and pancreas but not in liver or brain, and isoform 2 is expressed solely in cardiac and skeletal muscle.
  • Sequence similarities

    Belongs to the glutaminase family.
    Contains 1 ANK repeat.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • Example of specific activity of ab198065

  • 4-20% SDS-PAGE analysis of 4 µg ab198065 with Coomassie staining.

References

ab198065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up