Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSE PKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCE VFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWP SNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPA QWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGA GCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS VTEALIRTCLLNETGDEPFQYKN
    • Molecular weight
      42 kDa
    • Amino acids
      1 to 373

Specifications

Our Abpromise guarantee covers the use of ab222354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 2.000 pmol/min/ug, and is defined as the amount of enzyme that convert L-glutamate to L-glutamine per miunte at pH 7.5 at 37C in coupled system with PK/LDH.

  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.02% DTT, 10% Glycerol, 0.002% PMSF, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • cell proliferation-inducing protein 59
    • GLNA
    • GLNA_HUMAN
    • GLNS
    • GLUL
    • Glutamate ammonia ligase
    • Glutamate decarboxylase
    • Glutamate--ammonia ligase
    • glutamine synthase
    • Glutamine synthetase
    • GS
    • PIG 43
    • PIG 59
    • PIG43
    • PIG59
    • Proliferation inducing protein 43
    see all
  • Function
    This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). Essential for proliferation of fetal skin fibroblasts.
  • Involvement in disease
    Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD) [MIM:610015]. CSGD is a rare developmental disorder with severe brain malformation resulting in multi-organ failure and neonatal death. Glutamine is largely absent from affected patients serum, urine and cerebrospinal fluid.
  • Sequence similarities
    Belongs to the glutamine synthetase family.
  • Developmental stage
    Expressed during early fetal stages.
  • Cellular localization
    Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • Recombinant human Glutamine synthetase (3μg) analysed by 15% SDS-PAGE.

References

ab222354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up