Description

  • Product name

    Recombinant Human Glutamine Synthetase protein
    See all Glutamine Synthetase proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab98145 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTTSASSHLNKGIKQVYMSLPQGEKVQAMY IWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLV PAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPW FGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCE DFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVG QEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 373
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Western blot

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.077% DTT, 0.316% Tris HCl, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • cell proliferation-inducing protein 59
    • Cgl2214
    • GLNA
    • GLNA_HUMAN
    • GLNS
    • GLUL
    • Glutamate ammonia ligase
    • Glutamate decarboxylase
    • Glutamate--ammonia ligase
    • glutamine synthase
    • Glutamine synthetase
    • glutamine synthetase I
    • GS
    • PIG 43
    • PIG 59
    • PIG43
    • PIG59
    • Proliferation inducing protein 43
    see all
  • Function

    This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). Essential for proliferation of fetal skin fibroblasts.
  • Involvement in disease

    Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD) [MIM:610015]. CSGD is a rare developmental disorder with severe brain malformation resulting in multi-organ failure and neonatal death. Glutamine is largely absent from affected patients serum, urine and cerebrospinal fluid.
  • Sequence similarities

    Belongs to the glutamine synthetase family.
  • Developmental stage

    Expressed during early fetal stages.
  • Cellular localization

    Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98145

References

ab98145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Question
Answer

Thank you very much for your reply.

I'm sending a free of charge vial on the order ***, which should arrive tomorrow.

Please keep me updated about the results with this new vial. If there is anything else that we can do for you, please let me know and I'll be happy to help.

Read More

Answer

Thank you again for letting us know about the trouble with this protein, and for your patience while the lab has worked to determine the cause of this problem. I apologize for the delay in resolving this.

The protein has been re-tested (please see gel image attached) and there are some very faint bands seen at higher molecular weights but they are not as intense as those in your image. We are not sure of the identities of these bands at this time. It is possible that a band around 100 kDa is a dimer of the protein, but it could also be an impurity. I am sorry but we only have the same lot in stock that you've previously used. Would you be interested in trying a new vial, in case this is an isolated problem? Alternatively we can issue a credit or refund for your purchase.

Please let me know if you would prefer a replacement, credit, or refund, and I'll arrange it promptly. If there is anything else that we can do for you, please don't hesitate to ask.

Read More

Answer

Thank you again for letting us know about the trouble with this protein and for your patience.

The lab is re-testing the protein that is in stock and we should have the results shortly. I will let you know the results of these tests as soon as possible.

I am sorry for the delay in resolving this, but if there is anything else that we can doin the meantime, please do let me know.

Read More

Answer

Thank you very much for your email and for sending the data.

I have forwarded this on to the lab and asked if they know the identity of these bands, andI've also enquired whetherthere are any other lots that do not show these extra bands.

I will be back in touch shortly once I have more information for you. I appreciate your patience, and if there is anything else that we can do for you in the meantime please let me know and I'll be happy to help.

Read More

Answer

Thank you very much for your call today and for letting us know about the trouble with this protein.

As we discussed, if you have an image of the results it would be very helpful for us, and also if you could send me the lot number I can ask the lab to check the QC data for this lot.

I look forward to hearing from you. Please let me know if you have any questions or if there is anything else that we can do for you.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up