Description

  • Product name

    Recombinant Human Glutaredoxin 1 protein (His tag)
    See all Glutaredoxin 1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITA TNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLK QIGALQ
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      1 to 106
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001112362

Specifications

Our Abpromise guarantee covers the use of ab219880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 0.02% DTT, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • GLRX
    • Glrx1
    • GLRX1_HUMAN
    • Glutaredoxin
    • Glutaredoxin-1
    • Glutaredoxin1
    • Grx
    • Grx 1
    • Grx1
    • MGC117407
    • Thioltransferase
    • Thioltransferase 1
    • Thioltransferase-1
    • Thioltransferase1
    • TTase
    • TTase 1
    • TTase-1
    • TTase1
    see all
  • Function

    Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
  • Sequence similarities

    Belongs to the glutaredoxin family.
    Contains 1 glutaredoxin domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab219880 stained overnight with Coomassie Blue.

    The protein migrates as 12.7 kDa under reducing condition SDS-PAGE.

References

ab219880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up