Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAMACRQEPQPQGPPPAAGAVASYDYL VIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAV HSEFMHDHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIE IIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLG ITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLR SFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLP VMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQNTNVK GIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSH PPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCA NKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEEL VTLR
    • Molecular weight

      54 kDa including tags
    • Amino acids

      43 to 522
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity: > 29 units/ml. One unit will reduce 1.0 µmol of oxidized glutathione per minute at pH 7.5 at 25°C.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • GLR1
    • GLUR
    • Glutathione reductase
    • Glutathione reductase mitochondrial
    • Glutathione reductase, mitochondrial
    • GR
    • Gr1
    • GRase
    • GRD 1
    • GRD1
    • GSHR_HUMAN
    • GSR
    • MGC78522
    see all
  • Function

    Maintains high levels of reduced glutathione in the cytosol.
  • Sequence similarities

    Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.
  • Domain

    Each subunit can be divided into 4 domains that are consecutive along the polypeptide chain. Domains 1 and 2 bind FAD and NADPH, respectively. Domain 4 forms the interface.
  • Cellular localization

    Cytoplasm and Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of ab167979 at 3 µg.

References

ab167979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up