Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK FKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL ENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAG NKGLEKISAYMKSSRFLPRPVFSKMAVWGNK
    • Amino acids
      1 to 181
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glutathione S alkyltransferase
    • Glutathione S aralkyltransferase
    • Glutathione S aryltransferase
    • Glutathione S transferase M1
    • Glutathione S transferase mu
    • Glutathione S transferase mu 1
    • Glutathione S-transferase Mu 1
    • GST class Mu
    • GST class mu 1
    • GST class-mu 1
    • GST HB subunit 4
    • GST mu
    • GST1
    • Gstm1
    • GSTM1 1
    • GSTM1-1
    • GSTM1_HUMAN
    • GSTM1a 1a
    • GSTM1a-1a
    • GSTM1b 1b
    • GSTM1b-1b
    • GTH4
    • GTM1
    • H B
    • HB subunit 4
    • MGC26563
    • MU
    • MU 1
    • S (hydroxyalkyl)glutathione lyase
    see all
  • Function
    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Tissue specificity
    Liver (at protein level).
  • Sequence similarities
    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab158598 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up