Recombinant Human Glutathione S Transferase mu protein (denatured) (ab177627)

Description

  • Product name

    Recombinant Human Glutathione S Transferase mu protein (denatured)
    See all Glutathione S Transferase mu proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHRSMPMILGYWDIRGLAHAIRLLLEYTDSSY EEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILC YIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYL EELPEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVW GNK
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 181
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Isoform 2. NP_666533
  • Description

    Recombinant Human Glutathione S Transferase mu protein

Specifications

Our Abpromise guarantee covers the use of ab177627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • Glutathione S alkyltransferase
    • Glutathione S aralkyltransferase
    • Glutathione S aryltransferase
    • Glutathione S transferase M1
    • Glutathione S transferase mu
    • Glutathione S transferase mu 1
    • Glutathione S-transferase Mu 1
    • GST class Mu
    • GST class mu 1
    • GST class-mu 1
    • GST HB subunit 4
    • GST mu
    • GST1
    • Gstm1
    • GSTM1 1
    • GSTM1-1
    • GSTM1_HUMAN
    • GSTM1a 1a
    • GSTM1a-1a
    • GSTM1b 1b
    • GSTM1b-1b
    • GTH4
    • GTM1
    • H B
    • HB subunit 4
    • MGC26563
    • MU
    • MU 1
    • S (hydroxyalkyl)glutathione lyase
    see all
  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
  • Tissue specificity

    Liver (at protein level).
  • Sequence similarities

    Belongs to the GST superfamily. Mu family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177627 (3 µg).

References

ab177627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up