Recombinant Human Glycerol 3 Phosphate Dehydrogenase protein (His tag) (ab220575)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKL TEIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGK ICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGA NIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEIC GALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSA TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP ETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 349
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (AAH32234).

Specifications

Our Abpromise guarantee covers the use of ab220575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.87% Sodium chloride, 5% Trehalose, 0.61% Tris

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • AI747587
    • cytoplasmic
    • EC 1.1.1.8
    • FLJ26652
    • G3PD
    • Gdc-1
    • Gdc1
    • Gdp1
    • Glycerol 3 phosphate dehydrogenase 1
    • Glycerol 3 phosphate dehydrogenase cytosolic
    • Glycerol 3 phosphate dehydrogenase soluble
    • Glycerol-3-phosphate dehydrogenase
    • Glycerol-3-phosphate dehydrogenase [NAD+]
    • Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    • Glycerol-3-phosphate dehydrogenase 1 (soluble)
    • Glycerol-3-phosphate dehydrogenase, soluble
    • Glycerphosphate dehydrogenase
    • GPD-C
    • gpd1
    • Gpd1 protein
    • Gpd3
    • GPDA_HUMAN
    • Gpdc
    • GPDH
    • GPDH-C
    • Gpdhc
    • HTGTI
    • KIAA4010
    • MGC93453
    • MGPD
    • mKIAA4010
    see all
  • Sequence similarities

    Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220575 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 34 kDa in SDS-PAGE .

References

ab220575 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220575.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up