Description

  • Product name

    Recombinant Human Glypican 1/ GPC1 protein (His tag)
    See all Glypican 1/ GPC1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HHHHHHENLYFQGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLR ICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDH FQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLE ETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELR LRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCL GVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGV ESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR RGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTA SDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQL KIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSS RTPLTHALPGLSEQEGQKT
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      22 to 529
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature full length protein without signal and without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab215589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • FLJ38078
    • glypican
    • Glypican proteoglycan 1
    • glypican1
    • GPC 1
    • Gpc1
    • GPC1_HUMAN
    • Secreted glypican-1
    see all
  • Function

    Cell surface proteoglycan that bears heparan sulfate.
  • Sequence similarities

    Belongs to the glypican family.
  • Post-translational
    modifications

    This cell-associated glypican is further processed to give rise to a medium-released species.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab215589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up