Bioactive grade

Recombinant human Glypican 3 protein (Fc Chimera Active) (ab220538)

Description

  • Product name

    Recombinant human Glypican 3 protein (Fc Chimera Active)
    See all Glypican 3 proteins and peptides
  • Biological activity

    Immobilized Human FGF basic, Tag Free at 2μg/mL (100 μL/well) can bind ab220538 with a linear range of 0.48-7.8 ng/mL.

  • Purity

    > 90 % SDS-PAGE.
    2-8% human IgG1 Fc fragment as determined by SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCS RKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKN YTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSL FPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQ VTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPC GGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLF STIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLK VAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWN GQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLR TMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLA ELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVH
    • Predicted molecular weight

      87 kDa including tags
    • Amino acids

      25 to 559
    • Additional sequence information

      Fc fragment of human IgG1 at the N-terminus. (Accession # NP_004475).

Specifications

Our Abpromise guarantee covers the use of ab220538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.75% Glycine, 5% Trehalose, 0.61% Tris

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • DGSX
    • Glypican proteoglycan 3
    • Glypican-3 [Precursor]
    • Gpc3
    • GPC3_HUMAN
    • GTR2 2
    • GTR2-2
    • Heparan sulphate proteoglycan
    • Intestinal protein OCI 5
    • Intestinal protein OCI-5
    • MXR7
    • OCI 5
    • OCI-5
    • OCI5
    • SDYS
    • Secreted glypican-3
    • SGB
    • SGBS
    • SGBS1
    see all
  • Function

    Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition.
  • Tissue specificity

    Highly expressed in lung, liver and kidney.
  • Involvement in disease

    Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1) [MIM:312870]; also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies.
  • Sequence similarities

    Belongs to the glypican family.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • Human Glypican 3, Fc Tag, low endotoxin on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized Human Glypican 3, Fc Tag, low endotoxin at 0.5 µg/mL (100 µL/well) can bind Anti-Human GPC3 Mab with a linear range of 0.8-6 ng/mL.
  • Immobilized Human FGF basic, Tag Free at 2 µg/mL (100 µL/well)can bind Human Glypican 3, Fc Tag with a linear range of 4-63 ng/mL.
  • 293 cells were transfected with anti-GPC3-scFv and RFP tag. 2e5 of the cells were first stained with B. Human Glypican 3, Fc Tag, low endotoxin �and C. human Fc tag protein control, followed by FITC-conjugated anti-human IgG Fc antibody. A. Non-transfected 293 cells and C. human Fc tag protein control were used as negative control. RFP was used to evaluate CAR (anti-GPC3-scFv) expression and FITC was used to evaluate the binding activity of Human Glypican 3, Fc Tag, low endotoxin .
  • SDS-PAGE analysis of ab220538 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates ast 100 kDa, 58 kDa and 40 kDa.

References

ab220538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up