Recombinant human CD116 protein (Fc Chimera) (ab83993)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant human CD116 protein (Fc Chimera)
See all CD116 proteins and peptides -
Biological activity
ab83993 bound to protein A sepharose beads was able to pull down its ligand, GM-CSF. -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREG TAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCP YYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKK IERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNT QPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWS EAIEFGSDDGGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK -
Additional sequence information
Fusion of aa 1-320 of human GM-CSF Receptor alpha and aa 90-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.
-
Specifications
Our Abpromise guarantee covers the use of ab83993 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
ab83993 bound to protein A sepharose beads was able to pull down its ligand, GM-CSF.This product was previously labelled as GM-CSF Receptor alpha
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
General Info
-
Alternative names
- CD_antigen=CD116
- CD116
- CD116 antigen
see all -
Function
Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. -
Involvement in disease
Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) [MIM:300770]. A rare lung disorder due to impaired surfactant homeostasis. It is characterized by alveolar filling with floccular material that stains positive using the periodic acid-Schiff method and is derived from surfactant phospholipids and protein components. Excessive lipoproteins accumulation in the alveoli results in severe respiratory distress. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 5 subfamily. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MW and pI of the protein. -
1D SDS-PAGE of ab83993 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab83993
Lane 2: ab83993 treated with PNGase F to remove potential N-linked glycans
Lane 3: ab83993 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
Approximately 5 μg of protein was loaded per lane; Gel was stained using Deep Purple™. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A tightening of the band after treatment with the glycosidase cocktail indicates O-linked glycans may be present. Additional bands in lane 2 and lane 3 are glycosidase enzymes.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab83993 has not yet been referenced specifically in any publications.