Description

  • Product name

    Recombinant Human GMFB protein
    See all GMFB proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab99216 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNA AIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDG RVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFH
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 142
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as GMF beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Glia maturation factor beta
    • GMF
    • GMF-beta
    • GMFB
    • GMFB_HUMAN
    see all
  • Function

    This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
  • Sequence similarities

    Belongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications

    Phosphorylated; stimulated by phorbol ester.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99216.

References

ab99216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up