Overview

  • Product name

    Recombinant Human GNA13 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVK ILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLV DAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIR ALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLAR RPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSS EFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI NTENIRLVFRDVKDTILHDNLKQLMLQ
    • Amino acids

      1 to 377
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as G protein alpha 13

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G alpha 13
    • G alpha-13
    • G-protein subunit alpha-13
    • GNA13
    • GNA13_HUMAN
    • Guanine nucleotide binding protein (G protein) alpha 13
    • Guanine nucleotide binding protein alpha 13 subunit
    • Guanine nucleotide-binding protein subunit alpha-13
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Sequence similarities

    Belongs to the G-alpha family. G(12) subfamily.
  • Post-translational
    modifications

    Palmitoylation is critical for proper membrane localization and signaling.
    Phosphorylation on Thr-203 by PKA destabilizes the heterotrimer of alpha, beta and gamma, and inhibits Rho activation.
  • Cellular localization

    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab153115 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up