Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIV KQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSR ADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLN DSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMF DVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKL FDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK DCGLF
    • Molecular weight

      65 kDa including tags
    • Amino acids

      1 to 355

Specifications

Our Abpromise guarantee covers the use of ab132216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

     This product was previously labelled as G protein alpha Inhibitor 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adenylate cyclase inhibiting G alpha protein
    • Adenylate cyclase-inhibiting G alpha protein
    • GIP
    • GNAI 2
    • Gnai2
    • GNAI2_HUMAN
    • GNAI2B
    • GTP binding regulatory protein Gi alpha 2 chain
    • Guanine nucleotide binding protein G protein alpha inhibiting activity polypeptide 2
    • Guanine nucleotide-binding protein G(i) subunit alpha-2
    • H LUCA15.1
    • H LUCA16.1
    • WUGSC:H LUCA15.1
    • WUGSC:H LUCA16.1
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division.
  • Sequence similarities

    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cell membrane. Localizes in the centrosomes of interphase and mitotic cells. Detected at the cleavage furrow and/or the midbody.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132216 stained with Coomassie Blue.

References

ab132216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up