Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGCTVSAEDKAAAERSKMIDKNLREDGEKA AREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQS IMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRR LWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSA YDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDT KNVQFVFDAVTDVIIKNNLKDCGLF
    • Molecular weight

      42 kDa including tags
    • Amino acids

      1 to 355
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134531 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as G protein alpha Inhibitor 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Adenylate cyclase inhibiting G alpha protein
    • Adenylate cyclase-inhibiting G alpha protein
    • GIP
    • GNAI 2
    • Gnai2
    • GNAI2_HUMAN
    • GNAI2B
    • GTP binding regulatory protein Gi alpha 2 chain
    • Guanine nucleotide binding protein G protein alpha inhibiting activity polypeptide 2
    • Guanine nucleotide-binding protein G(i) subunit alpha-2
    • H LUCA15.1
    • H LUCA16.1
    • WUGSC:H LUCA15.1
    • WUGSC:H LUCA16.1
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli. May play a role in cell division.
  • Sequence similarities

    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cell membrane. Localizes in the centrosomes of interphase and mitotic cells. Detected at the cleavage furrow and/or the midbody.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134531.

References

ab134531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up