Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGLCYSLRPLLFGGPGDDPCAASEPPVEDAQPAPAPALAPVRAAARDTAR TLLPRGGEGSPACARPKADKPKEKRQRTEQLSAEEREAAKEREAVKEARK VSRGIDRMLRDQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPE EKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAP ITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVS LVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQ CFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTIS IILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTR AKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRM HLKQYELL
    • Molecular weight

      79 kDa including tags
    • Amino acids

      1 to 458

Specifications

Our Abpromise guarantee covers the use of ab132841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Adenylate cyclase stimulating G alpha protein, olfactory type
    • Adenylate cyclase-stimulating G alpha protein
    • DYT25
    • G alpha olf
    • Gnal
    • GNAL_HUMAN
    • Guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type
    • Guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide, olfactory type
    • Guanine nucleotide binding protein G(olf) subunit alpha
    • Guanine nucleotide-binding protein G(olf) subunit alpha
    • olfactory type
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. May be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.
  • Tissue specificity

    Detected in olfactory neuroepithelium, brain, testis, and to a lower extent in retina, lung alveoli, spleen. Trace amounts where seen in kidney, adrenal gland and liver. Found to be expressed in all the insulinomas examined.
  • Sequence similarities

    Belongs to the G-alpha family. G(s) subfamily.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132841 stained with Coomassie Blue.

References

ab132841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up