Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIV KQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSC ADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLND SASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFD VGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLF NSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD CGLF
    • Amino acids
      1 to 354
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACHM4
    • Cone type transducin alpha subunit
    • GNAT 2
    • GNAT C
    • Gnat2
    • GNAT2_HUMAN
    • GNATC
    • Guanine nucleotide binding protein (G protein) alpha transducing activity polypeptide 2
    • Guanine nucleotide binding protein G t subunit alpha 2
    • Guanine nucleotide-binding protein G(t) subunit alpha-2
    • Transducin alpha 2
    • Transducin alpha-2 chain
    • Transducin alpha2
    • Transducin cone specific alpha polypeptide
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.
  • Tissue specificity
    Retinal rod outer segment.
  • Involvement in disease
    Defects in GNAT2 are the cause of achromatopsia type 4 (ACHM4) [MIM:139340]. Achromatopsia is an autosomal recessively inherited visual disorder that is present from birth and that features the absence of color discrimination.
  • Sequence similarities
    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Information by UniProt

Images

  • ab158541 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up