Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGCRQSSEEKEAARRSRRIDRHLRSESQRQ RREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYKPLIIYNAIDS LTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRR LWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRD MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSG YDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIR RIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDT SNIQFVFDAVTDVIIQNNLKYIGLC
    • Molecular weight

      43 kDa including tags
    • Amino acids

      1 to 355
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as G protein alpha z, G Protein alpha x+z

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • G(x) alpha chain
    • GNAZ
    • GNAZ_HUMAN
    • Guanine nucleotide binding protein (G protein) alpha z polypeptide
    • Guanine nucleotide binding protein G(z) alpha subunit G(x) alpha chain
    • Guanine nucleotide binding protein G(z) subunit alpha
    • Guanine nucleotide-binding protein G(z) subunit alpha
    • Gz alpha
    • Gz-alpha
    • Human Gx alpha gene
    • Transducin alpha
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Sequence similarities

    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134541.

References

ab134541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up