Description

  • Product name

    Recombinant Human GNAX+GNAZ protein (Tagged)
    See all GNAX+GNAZ proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVK QMKIIHSGGFNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRA YDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLED NAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVD VGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLF DSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAA VYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKY IGLC
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      2 to 355
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab235560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as G protein alpha z, G Protein alpha x+z

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • G(x) alpha chain
    • GNAZ
    • GNAZ_HUMAN
    • Guanine nucleotide binding protein (G protein) alpha z polypeptide
    • Guanine nucleotide binding protein G(z) alpha subunit G(x) alpha chain
    • Guanine nucleotide binding protein G(z) subunit alpha
    • Guanine nucleotide-binding protein G(z) subunit alpha
    • Gz alpha
    • Gz-alpha
    • Human Gx alpha gene
    • Transducin alpha
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Sequence similarities

    Belongs to the G-alpha family. G(i/o/t/z) subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235560.

References

ab235560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up