Overview

  • Product name

    Recombinant Human GNB2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRT LRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWV MTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCR FLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFV SGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATC RLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
    • Amino acids

      1 to 340
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G protein beta 2 subunit
    • G protein subunit beta 2
    • G protein subunit beta-2
    • GBB2_HUMAN
    • Gnb2
    • Gnb2l1
    • Guanine nucleotide binding protein beta 2 subunit
    • Guanine nucleotide binding protein G I G S G T beta 2 subunit 2
    • Guanine nucleotide binding protein G protein beta polypeptide 2
    • Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
    • OTTHUMP00000174601
    • OTTHUMP00000174602
    • RACK1
    • Receptor for activated C kinase
    • Receptor of activated protein kinase C 1
    • Signal transducing guanine nucleotide binding regulatory protein beta
    • Transducin beta chain 2
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Sequence similarities

    Belongs to the WD repeat G protein beta family.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • ab158542 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up