Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGEMEQLRQEAEQLKKQIADARKACAGVTLAELVSGLEVVGRVQMRTRRT LRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWV MTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCR FLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFI SGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASC RLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSM KSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 340

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G protein beta 3 subunit
    • GBB3_HUMAN
    • GNB3
    • GNB3 guanine nucleotide binding protein (G protein), beta polypeptide 3
    • GTP binding regulatory protein beta 3 chain
    • Guanine nucleotide binding protein (G protein) beta polypeptide 3
    • Guanine nucleotide binding protein G
    • Guanine nucleotide binding protein G(I)/G(S)/G(T) beta subunit 3
    • Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
    • Hypertension associated protein
    • IG
    • SG
    • Transducin beta chain 3
    • Tsubunit beta 3
    see all
  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Sequence similarities

    Belongs to the WD repeat G protein beta family.
    Contains 7 WD repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132522 stained with Coomassie Blue.

References

ab132522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up