Description

  • Product name

    Recombinant Human GNL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDT SDGESVTHHIRRLNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAA REQVLQPVSAELLELDIREVYQPGSVLDFPRRPPWSYEMSKEQLMSQEER SFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSDIVLLITDIRHP VVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKHYFHQHYPQLH VVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVG KVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTG PTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQT YFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTAVGYLASR IPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYR AANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELVVLQGRVGPAG DEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYA LLGEDEC
    • Amino acids

      1 to 607
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gnl1
    • GNL1_HUMAN
    • GTP binding protein HSR1
    • GTP-binding protein HSR1
    • Guanine nucleotide binding protein like 1
    • Guanine nucleotide-binding protein-like 1
    • HSR1
    • HSR1 GTP binding protein
    see all
  • Function

    Possible regulatory or functional link with the histocompatibility cluster.
  • Sequence similarities

    Belongs to the MMR1/HSR1 GTP-binding protein family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • Domain

    In contrast to other GTP-binding proteins, this family is characterized by a circular permutation of the GTPase motifs described by a G4-G1-G3 pattern.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab158551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up