Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTI VQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGL VAGETAQQICEDLRLCIPSTGPL
    • Molecular weight
      15 kDa including tags
    • Amino acids
      23 to 145
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab175462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Mass Spectrometry

    ELISA

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 95 % Densitometry.
    ab175462 is purified using Ni-NTA chromatography.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of 0.5 mg/mL.

General Info

  • Alternative names
    • 519
    • D2S69E
    • GNLY
    • GNLY_HUMAN
    • Granulysin
    • Granulysin precursor
    • LAG 2
    • LAG2
    • Lymphocyte activation gene 2
    • Lymphokine LAG 2
    • Lymphokine LAG-2
    • NKG 5
    • NKG5
    • Protein NKG5
    • T cell activation protein 519
    • T lymphocyte activation gene 519
    • T-cell activation protein 519
    • TLA519
    see all
  • Function
    Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
  • Tissue specificity
    Expressed in natural killer and T-cells.
  • Sequence similarities
    Contains 1 saposin B-type domain.
  • Post-translational
    modifications
    A 9 kDa form is produced by proteolytic processing of a 15 kDa protein.
  • Cellular localization
    Secreted. Located in the cytotoxic granules of T-cells, which are released upon antigen stimulation.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab175462

    Lane 1: reduced and heated sample (2.5 μg)

    Lane 2: non-reduced and non-heated sample (2.5 μg)

References

ab175462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up