Description

  • Product name

    Recombinant Human GNPAT/DAPAT protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESSSSSNSYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSDLKF AMKCYTPLVYKGITPCKPIDIKCSVLNSEEIHYVIKQLSKESLQSVDVLR EEVSEILDEMSHKLRLGAIRFCAFTLSKVFKQIFSKVCVNEEGIQKLQRA IQEHPVVLLPSHRSYIDFLMLSFLLYNYDLPVPVIAAGMDFLGMKMVGEL LRMSGAFFMRRTFGGNKLYWAVFSEYVKTMLRNGYAPVEFFLEGTRSRSA KTLTPKFGLLNIVMEPFFKREVFDTYLVPISISYDKILEETLYVYELLGV PKPKESTTGLLKARKILSENFGSIHVYFGDPVSLRSLAAGRMSRSSYNLV PRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSM DFDALVEKTLWLKGLTQAFGGFLIWPDNKPAEEVVPASILLHSNIASLVK DQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFVRPSLVAVALQ MTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQ VTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKYLLSEEEDHFSEEQY LAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNC IFNVNEPATTKLEEMLGCKTPIGKPATAKL
    • Amino acids

      1 to 680
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as GNPAT

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Acyl CoA dihydroxyacetonephosphateacyltransferase
    • Acyl-CoA:dihydroxyacetonephosphateacyltransferase
    • DAP AT
    • DAP-AT
    • DAPAT
    • DHAP AT
    • DHAP-AT
    • DHAPAT
    • Dihydroxyacetone phosphate acyltransferase
    • EC 2.3.1.42
    • Glycerone-phosphate O-acyltransferase
    • Glyceronephosphate O acyltransferase
    • GNPAT
    • GNPAT_HUMAN
    • OTTHUMP00000036147
    see all
  • Pathway

    Membrane lipid metabolism; glycerophospholipid metabolism.
  • Involvement in disease

    Defects in GNPAT are the cause of rhizomelic chondrodysplasia punctata type 2 (RCDP2) [MIM:222765]. RDCP2 is characterized by rhizomelic shortening of femur and humerus, vertebral disorders, cataract, cutaneous lesions and severe mental retardation.
  • Sequence similarities

    Belongs to the GPAT/DAPAT family.
  • Domain

    The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Cellular localization

    Peroxisome membrane. Exclusively localized to the lumenal side of the peroxisomal membrane.
  • Information by UniProt

Images

  • ab160029 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up