Recombinant Human GnRH protein (ab112295)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human GnRH protein
See all GnRH proteins and peptides -
Biological activity
useful for Antibody Production and Protein Array -
Expression system
Wheat germ -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVK EVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI -
Predicted molecular weight
36 kDa including tags -
Amino acids
1 to 92 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab112295 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Additional notes
useful for Antibody Production and Protein Array -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
Glutathione is reduced
General Info
-
Alternative names
- GnRH associated peptide 1
- GNRH1
- Gonadotrophin releasing hormone 1
see all -
Relevance
Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle. Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe. -
Cellular localization
Secreted
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab112295 has not yet been referenced specifically in any publications.