Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNT DLIYQTGPKSTYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVEN ASVPRPSSHFVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVF QSSQTSSVSSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKE NVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQ RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQ LAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTF QERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKY SDEKKRVDELQQQVKLYKLNLESSKQELIDYKQKATRILQSKEKLINSLK EGSGFEGLDSSTASSMELEELRHEKEMQREEIQKLMGQIHQLRSELQDME AQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLY RTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQ KQTMLESLSTEKNSLVFQLERLEQQMNSASGSSSNGSSINMSGIDNGEGT RLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVF VIIYMALLHLWVMIVLLTYTPEMHHDQPYGK
    • Amino acids
      1 to 731
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell proliferation inducing gene 31
    • Cell proliferation-inducing gene 31 protein
    • GOGA5_HUMAN
    • GOLGA 5
    • GOLGA5
    • Golgi autoantigen golgin subfamily a 5
    • Golgi integral membrane protein 5
    • Golgin 84
    • Golgin A5
    • Golgin subfamily A member 5
    • Golgin-84
    • Golgin84
    • GOLIM 5
    • GOLIM5
    • Protein Ret-II
    • PTC5
    • Ret fused gene 5
    • RET fused gene 5 protein
    • Ret II
    • Ret II protein
    • RET-fused gene 5 protein
    • RFG 5
    • RFG5
    see all
  • Function
    Involved in maintaining Golgi structure. Stimulates the formation of Golgi stacks and ribbons. Involved in intra-Golgi retrograde transport.
  • Tissue specificity
    Ubiquitous. Highly expressed in seminiferous tubules and Leydig cells in testis, and detected at much lower levels in the other tissues tested. Expression is very low or not detectable in spermatozoa.
  • Involvement in disease
    Defects in GOLGA5 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving GOLGA5 is found in thyroid papillary carcinomas. Translocation t(10;14)(q11;q32) with RET. The translocation generates the RET/GOLGA5 (PTC5) oncogene which was found in 2 cases of PACT in children exposed to radioactive fallout after Chernobyl.
  • Post-translational
    modifications
    Highly phosphorylated during mitosis. Phosphorylation is barely detectable during interphase.
  • Cellular localization
    Golgi apparatus membrane. Found throughout the Golgi, both on cisternae and, at higher abundance, on the tubulo-vesicular structures of the cis-Golgi network.
  • Information by UniProt

Images

  • ab160733 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up