Description

  • Product name

    Recombinant Human GOSR1/GS28 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRY SSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSL NAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYK SGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKS IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH
    • Amino acids

      1 to 250
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as GOSR1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 28 kDa cis Golgi SNARE p28
    • 28 kDa Golgi SNARE protein
    • cis-golgi SNARE
    • golgi integral membrane protein 2
    • Golgi SNAP receptor complex member 1
    • Golgi SNARE 28 kDa
    • GOLIM2
    • GOS28
    • GOS28/P28
    • GOSR1
    • GS25
    • Gs28
    • P28
    see all
  • Relevance

    GOSR1/GS28 is a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments; it is considered an essential component of the Golgi SNAP receptor (SNARE) complex.
  • Cellular localization

    Cell Membrane, Endoplasmic reticulum and Golgi Apparatus

Images

  • ab160530 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up