Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVI WPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSL MSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTP QYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQF CNITVAVRSPSMNVVDHHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      22 to 235
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • A33
    • Cell surface A33 antigen
    • Cell surface A33 antigen precursor
    • Glycoprotein A33
    • Glycoprotein A33 (transmembrane)
    • Gpa33
    • GPA33_HUMAN
    • MGC129986
    • MGC129987
    • OTTHUMP00000032346
    • Transmembrane glycoprotein A33
    see all
  • Function

    May play a role in cell-cell recognition and signaling.
  • Tissue specificity

    Expressed in normal gastrointestinal epithelium and in 95% of colon cancers.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated, contains approximately 8 kDa of N-linked carbohydrate.
    Palmitoylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab151802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up