Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFS NKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDL
    • Amino acids
      26 to 125
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A33
    • Cell surface A33 antigen
    • Cell surface A33 antigen precursor
    • Glycoprotein A33
    • Glycoprotein A33 (transmembrane)
    • Gpa33
    • GPA33_HUMAN
    • MGC129986
    • MGC129987
    • OTTHUMP00000032346
    • Transmembrane glycoprotein A33
    see all
  • Function
    May play a role in cell-cell recognition and signaling.
  • Tissue specificity
    Expressed in normal gastrointestinal epithelium and in 95% of colon cancers.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications
    N-glycosylated, contains approximately 8 kDa of N-linked carbohydrate.
    Palmitoylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160889 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up