Overview

  • Product name
    Recombinant Human GPCR GPR102 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNL LVMTSVLHFKQLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFG AKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYATKFTVSVSGI CISVSWILPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLI DFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESSSESYKIRVAK RERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE
    • Amino acids
      1 to 342
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 102
    • G-protein coupled receptor 102
    • GPR102
    • TA5
    • TAAR8
    • TAAR8_HUMAN
    • TaR-5
    • TaR-8
    • TAR5
    • Trace amine assiciated receptor 8
    • Trace amine receptor 5
    • Trace amine receptor 8
    • Trace amine-associated receptor 8
    • TRAR5
    see all
  • Function
    Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood.
  • Tissue specificity
    Expressed in kidney and amygdala. Not expressed in other tissues or brain regions tested.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164408 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up