Description

  • Product name

    Recombinant Human GPCR GPR31 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYA VYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALRFLLDLSRSV GMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGL LISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGI IRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQN LGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTL RGKGQAAEPPDFNPRDSYS
    • Amino acids

      1 to 319
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 12-(S)-HETE acid receptor
    • 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor
    • 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
    • 12-(S)-HYDROXYEICOSATETRAENOIC ACID RECEPTOR
    • 12-HETER
    • bA517H2.2 (G protein coupled receptor 31)
    • G protein coupled receptor 31
    • GPR31
    • HETER
    • HETER1
    • OTTHUMP00000017616
    • Probable G protein coupled receptor 31
    see all
  • Relevance

    GPCR GPR31 is a member of the G protein coupled receptor (GPCR) family. Members of this protein family contain seven putative transmembrane domains and may mediate signaling processes to the interior of the cell via activation of heterotrimeric G proteins. GPCR GPR31 is located on human chromosome 6q27.
  • Cellular localization

    Cell membrane; Multi pass membrane protein

Images

  • ab158567 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up