Overview

  • Product name
    Recombinant Human GPCR GPR34 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDE KLLSTVLTTSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIAD LLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISL DRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHN STMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISK RRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEP SRSESTSEFKPGYSLHDTSVAVKIQSSSKST
    • Amino acids
      1 to 381
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 34
    • GPCR 34
    • GPCR34
    • GPR 34
    • GPR34
    • OTTHUMP00000023148
    • OTTHUMP00000023149
    • OTTMUSP00000018373
    • Probable G protein coupled receptor 34
    see all
  • Relevance
    G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. GPCR GPR34 is a member of this family (subfamily Orphan-A). It has been reported to be expressed in the brain, particularly in caudate, frontal cortex, putamen, and thalamus, as well as in eye, liver, and testis. ESTs have been isolated from adipose, B-cell/lung/testis, eye, liver/spleen, placenta, tonsil, and uterus libraries.
  • Cellular localization
    Cell membrane; Multi-pass membrane protein.

Images

  • ab158568 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up