Overview

  • Product name
    Recombinant Human GPCR GPR37 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQ RRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGR GAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISE EEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKT ANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNP FYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTF TLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVL RQLSKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARLWWYFGCY FCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQMNCTVVALTIL YGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLF CLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR REMSTFASVGTHC
    • Amino acids
      1 to 613
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EDNRBL
    • Endothelin B receptor like protein 1
    • Endothelin B receptor-like protein 1
    • Endothelin receptor type B like
    • ETBR LP 1
    • ETBR-LP-1
    • ETBRLP1
    • G protein coupled receptor 37
    • G protein coupled receptor 37 endothelin receptor type B like
    • Gpr37
    • GPR37_HUMAN
    • hET(B)R LP
    • hET(B)RLP
    • PAELR
    • Parkin associated endothelin receptor like receptor
    • Parkin-associated endothelin receptor-like receptor
    • Probable G protein coupled receptor 37
    • Probable G-protein coupled receptor 37
    see all
  • Function
    Orphan receptor. May have a unique functional role in the central nervous system.
  • Tissue specificity
    Expressed in brain and spinal cord, and at lower levels in testis, placenta and liver, but no detectable expression observed in any other tissue. When overexpressed in cells, tends to become insoluble and unfolded. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (PDJ).
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    Ubiquitinated by PARK2 in the presence of UBE2E1 and UBE2L3 in the endoplasmic reticulum. The unfolded form is specifically ubiquitinated by SYVN1, which promotes its proteasomal degradation and prevents neuronal cell death.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab158569 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158569 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up