Overview

  • Product name

    Recombinant Human GPCR GPR65/TDAG8 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELG IYLFSLSLSDLLYALTLPLWIDYTWNKDNWTFSPALCKGSAFLMYMNFYS STAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWILETIFNAVML WEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTIL ICNRKVYQAVRHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRC ILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYD MWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE
    • Molecular weight

      66 kDa including tags
    • Amino acids

      1 to 337

Specifications

Our Abpromise guarantee covers the use of ab152877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as GPCR GPR65

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Dig1
    • G protein coupled receptor 65
    • G-protein coupled receptor 65
    • Gpcr25
    • GPR65
    • hTDAG8
    • Psychosine receptor
    • PSYR_HUMAN
    • T cell death associated gene 8
    • T cell death associated gene 8 protein
    • T-cell death-associated gene 8 protein
    • TDAG8
    see all
  • Function

    Receptor for the glycosphingolipid psychosine (PSY) and several related glycosphingolipids. May have a role in activation-induced cell death or differentiation of T-cells.
  • Tissue specificity

    Predominantly expressed in thymus, spleen, lymph nodes, small intestine, lung, placenta and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152877 stained with Coomassie Blue.

References

ab152877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up