Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFP NGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRH LW
    • Amino acids
      302 to 403
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A 69G12.1
    • A-69G12.1
    • G protein coupled receptor family C group 1 member B
    • G protein coupled receptor family C group 5 member B
    • G-protein coupled receptor family C group 5 member B
    • GPC5B_HUMAN
    • Gprc5b
    • LOC51704
    • RAIG-2
    • RAIG2
    • Retinoic acid responsive gene protein
    • Retinoic acid-induced gene 2 protein
    see all
  • Function
    Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
  • Tissue specificity
    Expression is high in kidney, pancreas, and testis, medium in brain, heart, prostate, small intestine, and spleen, low in liver, placenta, skeletal muscle, colon, ovary, and thymus, and not detectable in lung and peripheral leukocyte. According to PubMed:10945465, highly expressed in most brain areas examined, with the highest levels observed in corpus callosum, caudate nucleus, putamen, substantia nigra, thalamus, hippocampus, and spinal chord as well as in dorsal root ganglia (DRG). In the periphery, expression levels are relatively low, compared to the CNS, with the strongest expression detected in pancreas, testis, uterus, and stomach.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family.
  • Cellular localization
    Cell membrane. Cytoplasmic vesicle membrane. Localized in the plasma membrane and perinuclear vesicles.
  • Information by UniProt

Images

  • ab162643 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up