Description

  • Product name

    Recombinant Human GPCR MRGX2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDPTTPAWGTESTTVNGNDQAPLLLCGKETLIPVFLILFIALVGLVGNGF VLWLLGFRMRRNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISIN FPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVC VLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCG SSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFGIQWFLILWIW KDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL QRALQDIAEVDHSEGCFRQGTPEMSRSSLV
    • Amino acids

      1 to 330
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • G protein coupled receptor MRGX 2
    • G protein coupled receptor MRGX2
    • Mas related G protein coupled receptor member X2
    • Mas related gene MRGX 2
    • Mas related gene MRGX2
    • MAS related GPR member X2
    • Mas-related G-protein coupled receptor member X
    • Mas-related G-protein coupled receptor member X2
    • MRGPRX 2
    • MRGPRX2
    • MRGX 2
    • MRGX2
    • MRGX2_HUMAN
    see all
  • Function

    Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca(2+) but had no effect on basal or forskolin-stimulated cAMP levels, suggesting that this receptor is G(q)-coupled.
  • Tissue specificity

    Has a limited expression profile, both peripheral and within the central nervous system, with highest levels in dorsal root ganglion.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab165129 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up