Recombinant Human GPCR RDC1/CXCR-7 protein (ab153435)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFI YIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVW VVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFT NTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFY PEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSS RKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVS ETEYSALEQSTK
    • Amino acids
      1 to 362
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACKR3
    • atypical chemokine receptor 3
    • C X C chemokine receptor type 7
    • C-X-C chemokine receptor type 7
    • Chemokine (C-X-C motif) receptor 7
    • Chemokine C X C motif receptor 7
    • Chemokine orphan receptor 1
    • CMKOR1
    • CXC R7
    • CXC-R7
    • CXCR 7
    • CXCR-7
    • CXCR7
    • CXCR7_HUMAN
    • G protein coupled receptor
    • G protein coupled receptor 159
    • G protein coupled receptor RDC1 homolog
    • G-protein coupled receptor 159
    • G-protein coupled receptor RDC1 homolog
    • GPCR RDC1
    • GPR159
    • GPRN1
    • RDC 1
    • RDC-1
    • RDC1
    see all
  • Function
    Receptor for CXCL12/SDF1. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.
  • Tissue specificity
    Expressed in monocytes, basophils, and B-cells. Lower expression in CD4+ T-lymphocytes and natural killer cells.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153435 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up