Overview

  • Product name

    Recombinant Human GPCR TGR5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPA GCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLL ANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWT PGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDIC RLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLA YEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
    • Amino acids

      1 to 330
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BG 37
    • BG37
    • G protein coupled bile acid receptor 1
    • G protein coupled bile acid receptor BG 37
    • G protein coupled bile acid receptor BG37
    • G-protein coupled bile acid receptor 1
    • G-protein coupled receptor GPCR19
    • GPBAR 1
    • GPBAR_HUMAN
    • GPBAR1
    • GPCR
    • GPCR 19
    • GPCR19
    • GPR 131
    • GPR131
    • hBG 37
    • hBG37
    • hGPCR 19
    • hGPCR19
    • M BAR
    • M-BAR
    • Membrane bile acid receptor
    • Membrane type receptor for bile acids
    • Membrane-type receptor for bile acids
    • MGC40597
    • TGR 5
    • TGR5
    see all
  • Function

    Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids.
  • Tissue specificity

    Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse colon, descending colon, cecum and liver, but not in esophagus and rectum.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab153607 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up