Description

  • Product name

    Recombinant Human GPCR TGR7 protein
    See all GPCR TGR7 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIW LLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHEL MKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLW TLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLT LFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLP PEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQAL REEPELEGGETPTVGTNEMGA
    • Amino acids

      1 to 321
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Beta alanine receptor
    • Beta-alanine receptor
    • G protein coupled receptor TGR7
    • G-protein coupled receptor TGR7
    • mas related G protein coupled MRGD
    • Mas related G protein coupled receptor member D
    • MAS related GPR member D
    • Mas-related G-protein coupled receptor member D
    • MRGD
    • Mrgprd
    • MRGRD_HUMAN
    • TGR7
    see all
  • Function

    May regulate nociceptor function and/or development, including the sensation or modulation of pain. Functions as a specific membrane receptor for beta-alanine. Beta-alanine at micromolar doses specifically evoked Ca(2+) influx in cells expressing the receptor. Beta-alanine decreases forskolin-stimulated cAMP production in cells expressing the receptor, suggesting that the receptor couples with G-protein G(q) and G(i).
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
  • Cellular localization

    Cell membrane. Localized at the plasma membrane but internalized into the cytoplasm after treatment with beta-alanine.
  • Information by UniProt

Images

  • ab165111 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up