Description

  • Product name

    Recombinant Human GPD2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAFQKAVKGTLVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVN REPPSREAQLLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERD DFSSGTSSRSTKLIHGGVRYLQKAIMKLDIEQYRMVKEALHERANLLEIA PHLSAPLPIMLPVYKWWQLPYYWVGIKLYDLVAGSNCLKSSYVLSKSRAL EHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYGAATANYMEVVS LLKKTDPQTGKVHVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKMD DKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTI AGTTDTPTDVTHHPIPSEEDINFILNEV
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 378

Specifications

Our Abpromise guarantee covers the use of ab132692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GDH2
    • Glycerol 3 phosphate dehydrogenase 2
    • Glycerol 3 phosphate dehydrogenase 2 (mitochondrial)
    • Glycerol 3 phosphate dehydrogenase mitochondrial
    • Glycerol-3-phosphate dehydrogenase
    • GPD 2
    • GPD M
    • GPD-M
    • gpd2
    • GPDH M
    • GPDH-M
    • GPDM
    • GPDM_HUMAN
    • mGPDH
    • mitochondrial
    • Mitochondrial glycerophosphate dehydrogenase
    • mtGPD
    • OTTHUMP00000162788
    • OTTHUMP00000204452
    • OTTHUMP00000204453
    • OTTHUMP00000204458
    see all
  • Pathway

    Polyol metabolism; glycerol degradation via glycerol kinase pathway; glycerone phosphate from sn-glycerol 3-phosphate (anaerobic route): step 1/1.
  • Sequence similarities

    Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132692 stained with Coomassie Blue.

References

ab132692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up