Description

  • Product name

    Recombinant Human GPNMB protein
    See all GPNMB proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKN SWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCR NEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRW NFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYV PIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPS HFLNYSTINYKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPG PCPPPPPPPRPSKPTPSLATTLKSYDSNTPGPAGDNPLELSRIPDENCQI NRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSIP TEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLG DDTSLALTSTLISVP
    • Amino acids

      22 to 486
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names

    • Glycoprotein (transmembrane) nmb
    • Glycoprotein nmb
    • Glycoprotein nmb like protein
    • Gpnmb
    • GPNMB_HUMAN
    • HGFIN
    • NMB
    • Osteoactivin
    • Transmembrane glycoprotein
    • Transmembrane glycoprotein HGFIN
    • Transmembrane glycoprotein NMB
    see all
  • Function

    Could be a melanogenic enzyme.
  • Tissue specificity

    Not restricted to the melanocytic lineage.
  • Sequence similarities

    Belongs to the PMEL/NMB family.
    Contains 1 PKD domain.
  • Developmental stage

    Expression in poorly metastatic melanoma cell lines; no expression in highly metastatic melanoma cell lines.
  • Cellular localization

    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

References

ab151652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Recombinant human GPNMB protein was used in a blocking experiment to validate antibody cat. #ab188222 for immunohistochemistry on PFA-fixed rat spinal cord slices.

Abcam user community

Verified customer

Submitted Nov 21 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up